<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29257
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MENTCFRDSLWLQENILTKDTVTEYFSYSQFYDKNCNNEVLKMQNIHQSAQDLETFLSKMCGVQYTITYALEPALFIIKKCERLSPEKVRVIDYFYVMNGTVYQAPTEKEVFSTRYTNILFSMFSSLENMPFLVRAPSAQTEKRKGVSIGRMSGLFNAYAADYMENKQP |
| Length | 169 |
| Position | Head |
| Organism | Nematocida sp. 1 (strain ERTm2 / ATCC PRA-371) (Nematode killer fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Nematocida>
unclassified Nematocida.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.356 |
| Instability index | 62.72 |
| Isoelectric point | 5.90 |
| Molecular weight | 19718.33 |
| Publications | PubMed=22813931
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 114.22| 34| 54| 46| 79| 2
---------------------------------------------------------------------------
46- 79 (56.86/36.61) IHQSAQDLETFLSKMCGVQYTITYALEPALFIIK
102- 135 (57.36/36.98) VYQAPTEKEVFSTRYTNILFSMFSSLENMPFLVR
---------------------------------------------------------------------------
|