<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29251

Description Mediator of RNA polymerase II transcription subunit 12 (Fragment)
SequenceXTPNRRRKKQLNAAFLPQDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQKDNFWLVTARSQSAINTWFTDLAGTKPLTQLAKKVPIFSKKEEVFGY
Length130
PositionKinase
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.09
Grand average of hydropathy-0.685
Instability index40.10
Isoelectric point10.12
Molecular weight14419.17
Publications
PubMed=15772651

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29251
No repeats found
No repeats found











Associated diseases
Disease
breast cancer	PMID:29157917 PMID:30230586 PMID:27438523 PMID:26452386 PMID:26601288 PMID:22913342
prostate cancer	PMID:29157917 PMID:23836153 PMID:23661306 PMID:22610119 PMID:26924278 PMID:26383637
colon cancer	PMID:23178117 PMID:29507187
renal cell carcinoma	PMID:27050271
uterine tumors	PMID:31520353 PMID:26383637
Uterine leiomyoma (ULM)	PMID:33025089 PMID:23443020 PMID:30895261
endometrial polyps colorectal cancers	PMID:24980722
phyllodes tumors	PMID:25865354 PMID:30511242
extrauterine cancer	PMID:25595892
uterine smooth muscle tumors	PMID:28592321
colorectal cancers	PMID:23132392 PMID:28183795
castration-resistant prostate cancer	PMID:24938407
Breast fibroepithelial tumors	PMID:26437033
fibroadenomas	PMID:28513873
epithelial ovarian cancer	PMID:29735544
Thyroid Cancer	PMID:28634282
lung cancer	PMID:28055980
renal cancer	PMID:24504440 PMID:30895261
syndromic disorders Congenital heart disease	PMID:30905399
cardiovascular diseases	PMID:24751643
Alzheimer disease	PMID:21293490
Fragile X syndrome	PMID:31098807
uterine leiomyomas	PMID:25615570 PMID:32094355 PMID:25106763 PMID:30619444
Blepharophimosis	PMID:24715367
short humeri	PMID:24715367
hirschsprung disease	PMID:24715367
Goldberg-Shprintzen syndrome	PMID:24715367
Opitz-Kaveggia syndrome	PMID:24715367
breast fibroadenomas	PMID:25106763
pelvic inflammatory disease	PMID:28432313



























Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29251 with Med12 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) ILKRFA
130
135