<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29251

Description Mediator of RNA polymerase II transcription subunit 12 (Fragment)
SequenceXTPNRRRKKQLNAAFLPQDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQKDNFWLVTARSQSAINTWFTDLAGTKPLTQLAKKVPIFSKKEEVFGY
Length130
PositionKinase
OrganismHomo sapiens (Human)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo.
Aromaticity0.09
Grand average of hydropathy-0.685
Instability index40.10
Isoelectric point10.12
Molecular weight14419.17
Publications
PubMed=15772651

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29251
No repeats found
No repeats found











Associated diseases
Disease
breast cancer	PMID:29157917 PMID:30230586 PMID:27438523 PMID:26452386 PMID:26601288 PMID:22913342
prostate cancer	PMID:29157917 PMID:23836153 PMID:23661306 PMID:22610119 PMID:26924278 PMID:26383637
colon cancer	PMID:23178117 PMID:29507187
renal cell carcinoma	PMID:27050271
uterine tumors	PMID:31520353 PMID:26383637
Uterine leiomyoma (ULM)	PMID:33025089 PMID:23443020 PMID:30895261
endometrial polyps colorectal cancers	PMID:24980722
phyllodes tumors	PMID:25865354 PMID:30511242
extrauterine cancer	PMID:25595892
uterine smooth muscle tumors	PMID:28592321
colorectal cancers	PMID:23132392 PMID:28183795
castration-resistant prostate cancer	PMID:24938407
Breast fibroepithelial tumors	PMID:26437033
fibroadenomas	PMID:28513873
epithelial ovarian cancer	PMID:29735544
Thyroid Cancer	PMID:28634282
lung cancer	PMID:28055980
renal cancer	PMID:24504440 PMID:30895261
syndromic disorders Congenital heart disease	PMID:30905399
cardiovascular diseases	PMID:24751643
Alzheimer disease	PMID:21293490
Fragile X syndrome	PMID:31098807
uterine leiomyomas	PMID:25615570 PMID:32094355 PMID:25106763 PMID:30619444
Blepharophimosis	PMID:24715367
short humeri	PMID:24715367
hirschsprung disease	PMID:24715367
Goldberg-Shprintzen syndrome	PMID:24715367
Opitz-Kaveggia syndrome	PMID:24715367
breast fibroadenomas	PMID:25106763
pelvic inflammatory disease	PMID:28432313



























Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29251 with Med12 domain of Kingdom Metazoa
Unable to open file!