<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29250
| Description |
Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
| Sequence | VAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGSIKGTGCPSDFL |
| Length | 155 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.114 |
| Instability index | 51.60 |
| Isoelectric point | 9.37 |
| Molecular weight | 16818.68 |
| Publications | PubMed=15772651
PubMed=21269460
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29250
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.19| 19| 24| 75| 98| 1
---------------------------------------------------------------------------
80- 98 (32.58/22.40) QLTQKTSVPPQEPVSIIVP
106- 124 (31.61/11.58) GTTQQADIPRQQNSSVAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.28| 12| 24| 41| 52| 2
---------------------------------------------------------------------------
41- 52 (23.39/17.46) ATQLKWNVQFCL
68- 79 (19.89/14.00) AVVLKSKMLFFL
---------------------------------------------------------------------------
|
Associated diseases