| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MESNEVNSSFFPPPPPRHKLFTNKNLSLAKRLRAEADDYQEISDEHPFDRSKQQEIVGEELNEVDLRTLIQPPLLDWIRQNNGWNAFGDHEPWPDCSSGRASLEGMPKLYDPKMERKDALQALLNTLIHGYLELLQVLTNEGPTSLSTSTTATNTTTGGTAGTAPTSSKTDQIVSHIELTAFNIHGLCNELRPRQARETLKLMVAQQASEKRQKAILVSQTCEELRKQLVQIKNEHPSSSPADSRANPALPSKPRSPKQPTPIQDQALRSQGATTPRSAGYDFDLLASRLHNPLLPPSSSFS |
| Length | 302 |
| Position | Middle |
| Organism | Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) (Black stem rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.716 |
| Instability index | 62.02 |
| Isoelectric point | 6.26 |
| Molecular weight | 33532.18 |
| Publications | PubMed=21536894 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP29247
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.66| 18| 42| 237| 256| 2
---------------------------------------------------------------------------
237- 256 (31.48/19.89) PSSSPAD.....SR.ANPALPskPRS
276- 299 (27.18/11.81) PRSAGYDfdllaSRlHNPLLP..PSS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RHKLFTNKNLSLAKRLR 2) RSAGYDFDLL | 17 277 | 33 286 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab