Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MESNEVNSSFFPPPPPRHKLFTNKNLSLAKRLRAEADDYQEISDEHPFDRSKQQEIVGEELNEVDLRTLIQPPLLDWIRQNNGWNAFGDHEPWPDCSSGRASLEGMPKLYDPKMERKDALQALLNTLIHGYLELLQVLTNEGPTSLSTSTTATNTTTGGTAGTAPTSSKTDQIVSHIELTAFNIHGLCNELRPRQARETLKLMVAQQASEKRQKAILVSQTCEELRKQLVQIKNEHPSSSPADSRANPALPSKPRSPKQPTPIQDQALRSQGATTPRSAGYDFDLLASRLHNPLLPPSSSFS |
Length | 302 |
Position | Middle |
Organism | Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) (Black stem rust fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.716 |
Instability index | 62.02 |
Isoelectric point | 6.26 |
Molecular weight | 33532.18 |
Publications | PubMed=21536894 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29247 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.66| 18| 42| 237| 256| 2 --------------------------------------------------------------------------- 237- 256 (31.48/19.89) PSSSPAD.....SR.ANPALPskPRS 276- 299 (27.18/11.81) PRSAGYDfdllaSRlHNPLLP..PSS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RHKLFTNKNLSLAKRLR 2) RSAGYDFDLL | 17 277 | 33 286 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab