<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29246
| Description |
Uncharacterized protein |
| Sequence | MEVSARRENVPDAVPTAKFLQARITALSTTLIKRLENIFAVALDGTSVGTIPPASAGVPPPSLTDTAVQEFQLDIESAAVIRAAEEIMVLTRTMKEIWLFGGLDTLEKDHENDNNPQNEATKRKVEEDTRVVEEGFKKFLEKYETTIDWDDQKTKT |
| Length | 156 |
| Position | Head |
| Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.433 |
| Instability index | 42.74 |
| Isoelectric point | 4.71 |
| Molecular weight | 17405.43 |
| Publications | PubMed=24496724
PubMed=28348446
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29246
No repeats found
No repeats found
|