<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29240
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQEQPQQLPEAPFPAPPPFWKHFTVANEEQLRKLKAQGNDGSETKKLPLPLAYLTPPPPPPATAEYYTTFGQKQVIDPTKPSSLPRDQLLFDPDSPDLNHAVLLDRLTKSLLLNFLELTSILSLDPTKYAEKMEDIRQLVLNIHVVINMYRPHQARESVKDMLEEILEEGQREIDECDRLKERVEQFLRNVGEVKTANGVDGSIPADGASAGHASDDAKMEEQIKLWKMIHDMTD |
| Length | 237 |
| Position | Middle |
| Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.616 |
| Instability index | 56.95 |
| Isoelectric point | 4.88 |
| Molecular weight | 26815.13 |
| Publications | PubMed=24496724
PubMed=28348446
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29240
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.09| 11| 38| 10| 20| 1
---------------------------------------------------------------------------
10- 20 (24.45/ 9.98) LPEAPFPAPPP
51- 61 (23.65/ 9.47) LPLAYLTPPPP
---------------------------------------------------------------------------
|