<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29239
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSFLSPSTAVPLSPTSPPESGLKRRHQTETPSESPKSPSLMSVATKSYVSAYGTSQHQHTDEGSSRSAPRSPRKGPSASLPQQSIHPQSLPTPAHSVTGMSSFGMAEDLDQHRDKRPRLDGAGFGEADQSEVQTPTQATNHDRHNVTDTDITMTENADEPQNSLDRAADNTSRHAEGEVTLEQLQKDMGEAFLLCRSKVERQRPNPQKHLLALYGMNSLLHSVARIDPKTGEKINKLRKSYEGQIKSFGLAGRNKPVKAERNVEEDQPGPLRRMAGSSPWGLEPDAQWNAEHAKSKIEVTPDFRAKLKQAMQMQPGTVRDNTHWEDVLGFDKPKPTGFLPPRPATPVAPQPAFSRYANGVTARQSVPATAEPKRQTRGKKRSYGDDSFVGYGEGYSDPEDGDGDDGDDYGSQRKRKKVMLMA |
| Length | 422 |
| Position | Head |
| Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.022 |
| Instability index | 58.29 |
| Isoelectric point | 8.40 |
| Molecular weight | 46354.82 |
| Publications | PubMed=24496724
PubMed=28348446
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29239
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.55| 19| 28| 126| 144| 2
---------------------------------------------------------------------------
126- 144 (33.65/16.73) EADQSEVQTPTQATNHDRH
156- 174 (32.90/16.23) NADEPQNSLDRAADNTSRH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.91| 32| 33| 248| 279| 3
---------------------------------------------------------------------------
248- 279 (56.07/33.63) FGL...AGRN.KPVKAERNVEEDQPGPLRRMAGSSP
280- 315 (48.85/28.41) WGLepdAQWNaEHAKSKIEVTPDFRAKLKQAMQMQP
---------------------------------------------------------------------------
|