<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29236
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHEFALYGLVSKDDHHRMLQQLAGYTRMQPQHTIEIHLVFKPRTPAGLERLPSAGGTQGVLQQDVQKLKNMLNAGLYYLQLVGEVVPPPKLKGTEKGDVAMSDANGDANPTKSTPGTAVVNWHLDFKDTPEPGKQAVSTRLISRIPINDGDYIQFMNNFGYEYVSRYLVVGDNFYDYDTTLFVHKVLRLPQVSADGAIADTSFLSNISELPKLDGSGGYMLQASIDVVDGNHPELKERATRQLLGHKEALKQAVELTPGDRLALDTRLPVSSGRA |
| Length | 275 |
| Position | Head |
| Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.377 |
| Instability index | 33.79 |
| Isoelectric point | 6.13 |
| Molecular weight | 30326.03 |
| Publications | PubMed=24496724
PubMed=28348446
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29236
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 18| 20| 178| 196| 1
---------------------------------------------------------------------------
178- 196 (26.95/23.19) DTTlFVHKVLRLPQVSADG
200- 217 (30.95/21.44) DTS.FLSNISELPKLDGSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.73| 24| 26| 46| 69| 2
---------------------------------------------------------------------------
19- 41 (24.32/13.73) ..LQQL..AGYTRMQPQHTIEihlVFK
46- 69 (40.67/27.88) AGLERLPSAGGTQGVLQQDVQ...KLK
74- 92 (32.74/21.02) AGLYYLQLVG...EVVPP..P...KLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.73| 18| 20| 103| 120| 3
---------------------------------------------------------------------------
103- 120 (30.21/19.31) DANGDANPTKSTPGTAVV
125- 142 (30.52/19.58) DFKDTPEPGKQAVSTRLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.04| 18| 26| 221| 238| 4
---------------------------------------------------------------------------
221- 238 (29.59/19.34) LQASIDVVDGNHPELKER
250- 267 (28.45/18.34) LKQAVELTPGDRLALDTR
---------------------------------------------------------------------------
|