<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29234
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | METTTPPTPVSHRFTLELEFVLCLANPHYLQYLALNYPHLLNKPTTSQESAEDEDCDAARFARYLKYLYEYWRTPQYVKYLTHPGATLRNLELLQQEQFRKDIIRPDVIAKLCDTNPELNSPGQTTEAREPAIQQNT |
Length | 137 |
Position | Middle |
Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.665 |
Instability index | 43.89 |
Isoelectric point | 5.32 |
Molecular weight | 15972.80 |
Publications | PubMed=24496724
PubMed=28348446
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29234
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.48| 17| 37| 28| 44| 1
---------------------------------------------------------------------------
28- 44 (33.24/18.82) HYLQYL.....ALNYPHLLNKP
63- 84 (27.25/14.39) RYLKYLyeywrTPQYVKYLTHP
---------------------------------------------------------------------------
|