<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29231
| Description |
Serine/threonine-protein kinase ssn3 |
| Sequence | MSLCTELSHPNVVHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRPIPATMIKSILFQLLNGLYYLHQNWVLHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPAIDMWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGLPRRENWKGLVDMPEYPQLQSLVVNRGGSLYPTPSSSRGGGGSGGGSNGSGLENWYNNCLRHASYPPDKSPGQRGFQLLSELFEYDPDKRLTAERALHHEYFRNTDDGPHKGEIWVSNNCFEGLDEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDSLVPPAKRR |
| Length | 351 |
| Position | Kinase |
| Organism | Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast) (Wangiella dermatitidis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.415 |
| Instability index | 48.88 |
| Isoelectric point | 7.72 |
| Molecular weight | 39561.69 |
| Publications | PubMed=24496724
PubMed=28348446
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29231
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.40| 23| 47| 191| 213| 1
---------------------------------------------------------------------------
191- 213 (42.08/23.26) ENW.KGLVDMPEYPQLQSLVVNRG
239- 261 (39.89/21.73) ENWyNNCLRHASYPPDKS.PGQRG
265- 281 (17.43/ 6.13) ......LSELFEYDPDKRLTAER.
---------------------------------------------------------------------------
|