Description | Uncharacterized protein |
Sequence | MQSGGAGGDVDRALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVISKQLENMNEEIPDLVQHFACVPRMSTPNPADIPLLLRTREDPEMEDEDRQLMADKPREKNTEALQKLVVAHNDAVESLEETFNDMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGTYA |
Length | 174 |
Position | Head |
Organism | Phytophthora ramorum (Sudden oak death agent) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Phytophthora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.655 |
Instability index | 54.18 |
Isoelectric point | 5.25 |
Molecular weight | 19702.96 |
Publications | PubMed=16946064 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29222 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IPLLLRTREDP 2) QQFKYIESGTY | 85 163 | 95 173 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab