| Description | Uncharacterized protein |
| Sequence | MQSGGAGGDVDRALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVISKQLENMNEEIPDLVQHFACVPRMSTPNPADIPLLLRTREDPEMEDEDRQLMADKPREKNTEALQKLVVAHNDAVESLEETFNDMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGTYA |
| Length | 174 |
| Position | Head |
| Organism | Phytophthora ramorum (Sudden oak death agent) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Phytophthora. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.655 |
| Instability index | 54.18 |
| Isoelectric point | 5.25 |
| Molecular weight | 19702.96 |
| Publications | PubMed=16946064 |
| Annotated function |
ECO:0000250 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP29222 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) IPLLLRTREDP 2) QQFKYIESGTY | 85 163 | 95 173 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab