<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29222
| Description |
Uncharacterized protein |
| Sequence | MQSGGAGGDVDRALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVISKQLENMNEEIPDLVQHFACVPRMSTPNPADIPLLLRTREDPEMEDEDRQLMADKPREKNTEALQKLVVAHNDAVESLEETFNDMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGTYA |
| Length | 174 |
| Position | Head |
| Organism | Phytophthora ramorum (Sudden oak death agent) |
| Kingdom | Oomycetes |
| Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae>
Phytophthora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.655 |
| Instability index | 54.18 |
| Isoelectric point | 5.25 |
| Molecular weight | 19702.96 |
| Publications | PubMed=16946064
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29222
No repeats found
No repeats found
|