Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MIMETIRENIVTPLAYYYIINGTVYQAPDAFSLVQSRLLGAVAPLGQAFEQMLKFSRFNVAKGYSWEFDKKPAPEGDEENDDEEDEALLRGGTSKKKADSDEAAHIAARSSTFQEQRTTNILQLLFEQFPPPSGVPAKPDAAAAAAAAGAAADQAAAASSAAGAAANPLGGLAAMLPPEVDRSNSFFESVA |
Length | 191 |
Position | Head |
Organism | Pristionchus pacificus (Parasitic nematode) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Diplogasteromorpha> Diplogasteroidea> Neodiplogasteridae> Pristionchus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.208 |
Instability index | 47.83 |
Isoelectric point | 4.50 |
Molecular weight | 20171.22 |
Publications | PubMed=18806794 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
GO - Biological Process | proteasome assembly GO:0043248 IEA:InterPro regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29217 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 136.17| 41| 56| 68| 108| 1 --------------------------------------------------------------------------- 68- 108 (68.91/37.75) FDKKPAPEGDEENDDEEDEALLRGGTSKKKADSDEAAHIAA 126- 166 (67.26/36.66) FEQFPPPSGVPAKPDAAAAAAAAGAAADQAAAASSAAGAAA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAAAAAGAAADQAAAASS 2) EALLR | 143 86 | 160 90 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab