<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29211
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSGEFGNASPNPLSQPSELLGSMDLLSVYDLSNSYNKFCSPQGMKRIAKEDLSSFLPHLYGEFNWQRGQEISWLKMLIEKPPITGKEIVPLNSSAMASFKLQPGIVDEPYRSLFDTGYEVKDGGQKDTKKEKRKLKMSIDPLEEDCIDNWAMDGNAPDMGSDEEGGTKKKKKKSDKDREERKERKKEKKEKKEKKKKEKEHN |
| Length | 202 |
| Position | Head |
| Organism | Pristionchus pacificus (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -1.186 |
| Instability index | 43.65 |
| Isoelectric point | 8.60 |
| Molecular weight | 23110.00 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29211
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.28| 21| 24| 16| 38| 2
---------------------------------------------------------------------------
16- 38 (28.34/26.95) PSEL..LGSMDLlSVYdLSNSYNKF
41- 63 (32.94/20.65) PQGMkrIAKEDL.SSF.LPHLYGEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.83| 10| 19| 81| 99| 3
---------------------------------------------------------------------------
81- 93 (14.31/27.83) PPITGKeivPLNS
103- 112 (19.52/ 6.34) PGIVDE...PYRS
---------------------------------------------------------------------------
|