<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29204
| Description |
Uncharacterized protein |
| Sequence | MQAAKPAGVGKSNQSSKGNASKVLVIQEYKRRLRDNIRSLNENFVQLITAAKIKQEDEVHKCPNGRMAEHATTRYEMKVRAALIVKACDELSKLTNDLKEFLILHDFNFLTEAISKAENECDDKLRHQLKKHNDLRIDIAKIVFDVDKELQEHFSLRP |
| Length | 158 |
| Position | Head |
| Organism | Pristionchus pacificus (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.620 |
| Instability index | 39.82 |
| Isoelectric point | 8.94 |
| Molecular weight | 18155.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29204
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.07| 11| 30| 88| 100| 1
---------------------------------------------------------------------------
88- 100 (15.67/16.72) CDElsKLTNDLKE
121- 131 (21.39/14.54) CDD..KLRHQLKK
---------------------------------------------------------------------------
|