<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29203
Description |
Uncharacterized protein |
Sequence | MSLVLNCEKGASAELTQKLKHFEQCLSDIHKIRLAFNDLKESKNKQKEKICDLRRQVTLKDGLINSFASDIIGEFESQGSPPISLFPLSHFASFVAFSTVV |
Length | 101 |
Position | Middle |
Organism | Pristionchus pacificus (Parasitic nematode) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.129 |
Instability index | 38.70 |
Isoelectric point | 7.74 |
Molecular weight | 11313.93 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29203
No repeats found
No repeats found
|