<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29202
| Description |
Uncharacterized protein |
| Sequence | MGVLSQGGAQQQQQGMYQQQQDDPSQQQGSQPMQMSYGISGMGQSNDLYMQQGQHYPMNAAPSGMNPHVYNSISSSLQARSPYSMGGMGGPQSIPQPMSVNPLSVPPQGPGSVSGQGPMSVPQQGPASVQGPMSVPQQGPCSVPGQGPLSVPQPLSMAGQGPLSVPQPLSMAGQGPLSVPQPGSVGQSGDSLGIGGLTVPGVMHSNQGPSPSSLSIPSHMGSYIDGQGRSPIGPGSMSGPSPCALPQGTSPSLGNPLSHGGPQSISAFNPSTPHNVPSQSQEKKDEESERYDGIFLLDPMQQSKQLITKDLRVSFSEMNKSMGEVLRNRDNVSVEQNEKYNRDYNEFMAVCDQVEQALTMVLETSKMMSKLDRSYTPDGGNTAGRKMGGKRVKPTTKIGTASKRLRLDSNWSEEIPSDKDDDFDARHMHGDSSGDEGTRHQNIFCKKRNKITSSEKAQMLNEPTGDIENLTPFGVLRYDRAVTSAGNFLKAGFGTN |
| Length | 496 |
| Position | Tail |
| Organism | Pristionchus pacificus (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.720 |
| Instability index | 68.83 |
| Isoelectric point | 6.00 |
| Molecular weight | 52610.04 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29202
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 222.96| 27| 27| 95| 121| 1
---------------------------------------------------------------------------
79- 106 (48.56/15.81) ARSPYSMGGMGgPQSIPQ...PMS..VN.........PLSVP
107- 136 (47.62/15.37) PQGPGSVSGQG.PMSVPQ.qgPAS..VQ........gPMSVP
137- 155 (33.28/ 8.64) QQGPCSVPGQG.PLSVPQ...PL...................
170- 200 (29.97/ 7.09) .....SMAGQG.PLSVPQ...PGS..VGqsgdslgigGLTVP
206- 230 (27.75/ 6.05) NQGPSPSS.....LSIPS...HMGsyID.........GQGRS
231- 258 (35.79/ 9.82) PIGPGSMSGPS.PCALPQgtsPSL..GN.........PLS..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.27| 20| 21| 22| 42| 2
---------------------------------------------------------------------------
22- 42 (36.28/15.69) DDPSQQQGsQPMQMSYGISGM
46- 65 (39.99/14.61) NDLYMQQG.QHYPMNAAPSGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.48| 32| 51| 266| 316| 3
---------------------------------------------------------------------------
268- 302 (53.02/57.50) FNPSTPH......NVPSQSQEKKDEEserYDGIF.LLDPMQQ
318- 356 (46.45/15.81) MNKSMGEvlrnrdNVSVEQNEKYNRD...YNEFMaVCDQVEQ
---------------------------------------------------------------------------
|