<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29195
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAAPPAAQIVSPFPTPPAYYQFYTSDNIANARVPLPPCAHADFTVFGEDYHLNDEIIRPLSEAGIRQLYVNKKDWKTEMKKLNSSAVAAFVDLVSILISCPDSQDRVDKLNDIRDIFINMHHLINEFRPIQARDTLRMMQQKQLDELERTVNDFKDFLVEAKKAFRQSLKVDEVVRLPIPAYRPDLEGPVEEPKRKEETKKREIELAMIGLSVGGERKQQAATSSSTPRPEQQQRLLQKRAMDHAAWSAIFGETMEE |
| Length | 257 |
| Position | Middle |
| Organism | Pristionchus pacificus (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Diplogasteromorpha> Diplogasteroidea> Neodiplogasteridae>
Pristionchus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.543 |
| Instability index | 53.78 |
| Isoelectric point | 5.84 |
| Molecular weight | 29393.21 |
| Publications | PubMed=18806794
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | embryo development ending in birth or egg hatching GO:0009792 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
reproduction GO:0000003 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP29195
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.94| 11| 18| 14| 24| 2
---------------------------------------------------------------------------
14- 24 (23.64/15.41) PTPPAYYQFYT
34- 44 (23.30/15.09) PLPPCAHADFT
---------------------------------------------------------------------------
|