Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAAPPAAQIVSPFPTPPAYYQFYTSDNIANARVPLPPCAHADFTVFGEDYHLNDEIIRPLSEAGIRQLYVNKKDWKTEMKKLNSSAVAAFVDLVSILISCPDSQDRVDKLNDIRDIFINMHHLINEFRPIQARDTLRMMQQKQLDELERTVNDFKDFLVEAKKAFRQSLKVDEVVRLPIPAYRPDLEGPVEEPKRKEETKKREIELAMIGLSVGGERKQQAATSSSTPRPEQQQRLLQKRAMDHAAWSAIFGETMEE |
Length | 257 |
Position | Middle |
Organism | Pristionchus pacificus (Parasitic nematode) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Diplogasteromorpha> Diplogasteroidea> Neodiplogasteridae> Pristionchus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.543 |
Instability index | 53.78 |
Isoelectric point | 5.84 |
Molecular weight | 29393.21 |
Publications | PubMed=18806794 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | embryo development ending in birth or egg hatching GO:0009792 IEA:EnsemblMetazoa regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central reproduction GO:0000003 IEA:EnsemblMetazoa |
Binary Interactions |
Repeats | >MDP29195 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 46.94| 11| 18| 14| 24| 2 --------------------------------------------------------------------------- 14- 24 (23.64/15.41) PTPPAYYQFYT 34- 44 (23.30/15.09) PLPPCAHADFT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AYYQFYT 2) RLLQKR | 18 235 | 24 240 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab