<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29190

Description Uncharacterized protein
SequenceMIDYAFKEELARNRERVDEIFHYEGSKIGRGTYGHVYKAVPKGISSPRYTAKEYALKLIDSQGFSMSACREIALLRELKHPNLINLQRVFLSSERKATGQLSLKVFLLLEYAEHDLWHIIKFHRSAKSKKAPVGIDYLHTNWILHRDLKPANILVMGDGDGVERGRVKIADMGFARIFNNPLKPLSELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTSEPLFFCREEDIKTQSPYHQDQLGRIFSVMGYPAEADWPDIKKMPEYPKLQQDFKKANYMNCSLQRYMEKYKQDTNSSQFKLLLKLLTMDPLKRLAADEAMKDAFFKEDPKPSNDVFGCLEHIPYPKREFMNDSEDDKKAQQAAAQQQAVAARHAAAQQAQAAAVAAQQQQQQQLMQQQQQAPQQPMMQPQMPPQEPAAKKMRMMPGMQPQPVYGGPTAGAGLPGQAAVAPGMQHYGGGPTAAGPSGVPMQQQQPQQQPYMQQMQPQQMGYGGGFGETQQQQHMMTQQQQQHNLNWNTKLKGREIEVKSCIGNCAHH
Length544
PositionKinase
OrganismPristionchus pacificus (Parasitic nematode)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Diplogasteromorpha> Diplogasteroidea> Neodiplogasteridae> Pristionchus.
Aromaticity0.09
Grand average of hydropathy-0.623
Instability index53.57
Isoelectric point8.86
Molecular weight61631.96
Publications
PubMed=18806794

Function

Annotated function 
GO - Cellular Component
endoplasmic reticulum lumen	GO:0005788	IEA:UniProtKB-SubCell
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
ribosome	GO:0005840	IEA:UniProtKB-KW

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IBA:GO_Central
structural constituent of ribosome	GO:0003735	IEA:InterPro
UDP-glucose:glycoprotein glucosyltransferase activity	GO:0003980	IEA:InterPro

GO - Biological Process
protein glycosylation	GO:0006486	IEA:UniProtKB-UniPathway
protein phosphorylation	GO:0006468	IBA:GO_Central
translation	GO:0006412	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.81|      36|      82|     374|     438|       1
---------------------------------------------------------------------------
  411-  483 (33.11/40.66)	QQPMMQpQMppqepaakkmrmmpgmQPQpvyggptagaglpgQAAVApgMQHygGGPTAAGpsGVPMQQQQPQ
  484-  519 (73.71/24.11)	QQPYMQ.QM................QPQ..............QMGYG..GGF..GETQQQQ..HMMTQQQQQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.57|      37|      84|     224|     284|       3
---------------------------------------------------------------------------
  224-  284 (32.71/84.68)	ELLTSEPL............FFcrEEDIKtqsPyHQDqlgrIFsvmGYpaeadwpdIKKMPeYPKlqQDF.......KKA
  312-  367 (59.85/37.28)	KLLTMDPLkrlaadeamkdaFF..KEDPK...P.SND....VF...GC........LEHIP.YPK..REFmndseddKKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.03|       9|      19|     424|     434|       5
---------------------------------------------------------------------------
  424-  434 (13.42/12.63)	PAAKKmrMMPG
  444-  452 (17.61/ 8.46)	PTAGA..GLPG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29190 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KREFMNDSEDDKKAQQAAAQQQAVAARHAAAQQAQAAAVAAQQQQQQQLMQQQQQAPQQPMMQPQMPPQEPAAKKMRMMPGMQPQPVYGGPTAGAGLPGQAAVAPGMQHYGGGPTAAGPSGVPMQQQQPQQQPYMQQMQPQQMGYGGGFGETQQQQHMMTQQQQQHNLNWNTKLKG
354
529










Molecular Recognition Features






MoRF SequenceStartStop




NANANA