<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29190
| Description |
Uncharacterized protein |
| Sequence | MIDYAFKEELARNRERVDEIFHYEGSKIGRGTYGHVYKAVPKGISSPRYTAKEYALKLIDSQGFSMSACREIALLRELKHPNLINLQRVFLSSERKATGQLSLKVFLLLEYAEHDLWHIIKFHRSAKSKKAPVGIDYLHTNWILHRDLKPANILVMGDGDGVERGRVKIADMGFARIFNNPLKPLSELDPVVVTFWYRAPELLLGAKHYTKAIDVWAIGCIFAELLTSEPLFFCREEDIKTQSPYHQDQLGRIFSVMGYPAEADWPDIKKMPEYPKLQQDFKKANYMNCSLQRYMEKYKQDTNSSQFKLLLKLLTMDPLKRLAADEAMKDAFFKEDPKPSNDVFGCLEHIPYPKREFMNDSEDDKKAQQAAAQQQAVAARHAAAQQAQAAAVAAQQQQQQQLMQQQQQAPQQPMMQPQMPPQEPAAKKMRMMPGMQPQPVYGGPTAGAGLPGQAAVAPGMQHYGGGPTAAGPSGVPMQQQQPQQQPYMQQMQPQQMGYGGGFGETQQQQHMMTQQQQQHNLNWNTKLKGREIEVKSCIGNCAHH |
| Length | 544 |
| Position | Kinase |
| Organism | Pristionchus pacificus (Parasitic nematode) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Diplogasteromorpha> Diplogasteroidea> Neodiplogasteridae>
Pristionchus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.623 |
| Instability index | 53.57 |
| Isoelectric point | 8.86 |
| Molecular weight | 61631.96 |
| Publications | PubMed=18806794
|
Function
| Annotated function |
|
| GO - Cellular Component | endoplasmic reticulum lumen GO:0005788 IEA:UniProtKB-SubCell
mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
ribosome GO:0005840 IEA:UniProtKB-KW
|
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IBA:GO_Central
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IBA:GO_Central
structural constituent of ribosome GO:0003735 IEA:InterPro
UDP-glucose:glycoprotein glucosyltransferase activity GO:0003980 IEA:InterPro
|
| GO - Biological Process | protein glycosylation GO:0006486 IEA:UniProtKB-UniPathway
protein phosphorylation GO:0006468 IBA:GO_Central
translation GO:0006412 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.81| 36| 82| 374| 438| 1
---------------------------------------------------------------------------
411- 483 (33.11/40.66) QQPMMQpQMppqepaakkmrmmpgmQPQpvyggptagaglpgQAAVApgMQHygGGPTAAGpsGVPMQQQQPQ
484- 519 (73.71/24.11) QQPYMQ.QM................QPQ..............QMGYG..GGF..GETQQQQ..HMMTQQQQQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.57| 37| 84| 224| 284| 3
---------------------------------------------------------------------------
224- 284 (32.71/84.68) ELLTSEPL............FFcrEEDIKtqsPyHQDqlgrIFsvmGYpaeadwpdIKKMPeYPKlqQDF.......KKA
312- 367 (59.85/37.28) KLLTMDPLkrlaadeamkdaFF..KEDPK...P.SND....VF...GC........LEHIP.YPK..REFmndseddKKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.03| 9| 19| 424| 434| 5
---------------------------------------------------------------------------
424- 434 (13.42/12.63) PAAKKmrMMPG
444- 452 (17.61/ 8.46) PTAGA..GLPG
---------------------------------------------------------------------------
|