<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29186
Description |
Zgc:114119 |
Sequence | SQQHPHLPPGGAPAPGQQPMPPQGALREISPVFLCRIGQETVQDIVTRTMEVFQIARATQLPNGVTQSQAMYQDRFGKLQEHLRQLTLLFRKLRLLYERCVEMTSDLQEGPAESLQLVPYVGEEMVSVKTESCSPAVSQERTEVLEINSVFQKVRQKNQEMKVLMDQMRNLLWDVNAMLTLRK |
Length | 183 |
Position | Head |
Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.417 |
Instability index | 60.82 |
Isoelectric point | 6.81 |
Molecular weight | 20857.88 |
Publications | PubMed=15496914
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29186
No repeats found
|