<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29180
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPSKPPPPLPQSQVALAAQMPPQHGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPVLLLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDTDPKKKKKKRDDDPDHEPSHVVCVRPQNRHSPDHPGLAGSQPNSSSSLR |
| Length | 248 |
| Position | Head |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.855 |
| Instability index | 59.09 |
| Isoelectric point | 9.11 |
| Molecular weight | 27228.64 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29180
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.19| 16| 19| 181| 198| 1
---------------------------------------------------------------------------
181- 198 (28.29/18.62) HKHKHHRPQDplPQETPS
203- 218 (29.90/13.61) KKKKKKRDDD..PDHEPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.44| 17| 26| 14| 36| 2
---------------------------------------------------------------------------
14- 32 (30.04/17.24) AQGPPGSSSlgFGPSKPPP
43- 59 (34.40/ 8.12) AQMPPQHGD..EGPALRKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.74| 18| 21| 98| 115| 3
---------------------------------------------------------------------------
98- 115 (32.08/18.23) C.GKKVKEKLSNFL..PELPG
119- 139 (24.66/12.47) CpGTQDGSSLRSLIdkPPVCG
---------------------------------------------------------------------------
|