Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPSKPPPPLPQSQVALAAQMPPQHGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPVLLLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQETPSDTDPKKKKKKRDDDPDHEPSHVVCVRPQNRHSPDHPGLAGSQPNSSSSLR |
Length | 248 |
Position | Head |
Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.855 |
Instability index | 59.09 |
Isoelectric point | 9.11 |
Molecular weight | 27228.64 |
Publications | PubMed=15496914 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP29180 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.19| 16| 19| 181| 198| 1 --------------------------------------------------------------------------- 181- 198 (28.29/18.62) HKHKHHRPQDplPQETPS 203- 218 (29.90/13.61) KKKKKKRDDD..PDHEPS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.44| 17| 26| 14| 36| 2 --------------------------------------------------------------------------- 14- 32 (30.04/17.24) AQGPPGSSSlgFGPSKPPP 43- 59 (34.40/ 8.12) AQMPPQHGD..EGPALRKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.74| 18| 21| 98| 115| 3 --------------------------------------------------------------------------- 98- 115 (32.08/18.23) C.GKKVKEKLSNFL..PELPG 119- 139 (24.66/12.47) CpGTQDGSSLRSLIdkPPVCG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PKKKKKKRDD 2) YRLMHI | 202 167 | 211 172 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab