<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29172
| Description |
Uncharacterized protein |
| Sequence | RRMSSYVPNGASLEDCHSNLFCLADLTGIKWKRFVWQGPTSAPMLFPVTEEDPILCSFSRCLKADVLSVWRRSQRQGRRELWLFWWGDDPNFADLIHHELAAEDDGLWENGLSYECRTLLFKAIHNLLERCLMNRSFVRIGKWFVKPYEKDEKPINKSEHLSCAFTFFLHGDSNVCTSVEINQHQPVYHLTEEHLTLAQQASSPFQGGS |
| Length | 209 |
| Position | Middle |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.378 |
| Instability index | 57.84 |
| Isoelectric point | 6.14 |
| Molecular weight | 24221.22 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29172
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.65| 25| 36| 31| 65| 1
---------------------------------------------------------------------------
22- 53 (36.51/35.33) CL.ADltgikWKRFVWQGPTSApMLFpVTEEDP
61- 90 (45.14/22.45) CLkAD.vlsvWRRSQRQGRREL.WLF.WWGDDP
---------------------------------------------------------------------------
|