<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29171
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | METEEQAKNRFQAELEFVQCLANPNYLNFLAQRGVFREKTFINYLKYLLYWKEPEYAKYLKYPHCLHMLELLQYEHFRKELVNAQCAKFIDEQQLLHWQHYSRKRMRLQQALAEQQQPQQQPLPHGNATTK |
| Length | 131 |
| Position | Middle |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.835 |
| Instability index | 44.71 |
| Isoelectric point | 8.73 |
| Molecular weight | 16020.18 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29171
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.85| 19| 21| 74| 94| 1
---------------------------------------------------------------------------
74- 94 (29.06/20.30) YEHFRKELVNAQCAkfIDEQQ
98- 116 (34.79/18.26) WQHYSRKRMRLQQA..LAEQQ
---------------------------------------------------------------------------
|