<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29165
| Description |
Mediator complex subunit 28 |
| Sequence | MASSMSGMFSGQQPTGAHPVGGPGGQGQPGFPGAVPRAQGGNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQIECFFLQKRFQLSVQKPEQVVKEDISELRNELQRKEMLVQKHLSKLHHWQQVLEEVSLQHRKPSDLPPPGPLTFLEQASANLPPAPLKPN |
| Length | 180 |
| Position | Head |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.501 |
| Instability index | 52.37 |
| Isoelectric point | 5.52 |
| Molecular weight | 19812.19 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.79| 15| 15| 105| 119| 1
---------------------------------------------------------------------------
105- 119 (24.43/15.27) QKPEQVVKEDISELR
123- 137 (25.37/16.07) QRKEMLVQKHLSKLH
---------------------------------------------------------------------------
|