<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29163
Description |
Mediator complex subunit 29 |
Sequence | MASQQQQAQPGGPMAQPGLQQPSALQQLSQQQDFDPVHRFKMLIPQLKESLQNVMKIASLNLAQNTSIDNGTKSSDASLQRFDKSLEEFYAICDQVELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESMSYGQYLGMIKSQITCAKDIHNALLECSKKIAGKVQPQGLM |
Length | 175 |
Position | Tail |
Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.426 |
Instability index | 64.88 |
Isoelectric point | 6.27 |
Molecular weight | 19271.80 |
Publications | PubMed=15496914
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP29163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.17| 23| 25| 3| 27| 1
---------------------------------------------------------------------------
3- 27 (38.58/27.49) SQQQQAQPGG..PMAQPGLQQpsALQQ
29- 53 (37.59/20.28) SQQQDFDPVHrfKMLIPQLKE..SLQN
---------------------------------------------------------------------------
|