<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29159
| Description |
Uncharacterized protein |
| Sequence | VLAQFHKQQLSSVVMPHPASAPFGHKRLRLAGPLAYDKTEISSLQHSEGLLEKIIKQAKIFLRSRTARTIDSLASRIEDPQIQAHWSNINDVYESSVKVLITSQGYEQICKSIQLQLNIGVEQIRVVHRDGRVVTLSHQEQELQDFLLSQMSQHQVHAVQQLAKVMGWHVLSFSNHVGLGPVESIGNASAITVASPNGENAISVRNGPESGCRVLIQFPRSQSKELPKNDVVQDAKWSHLRGPSKEVHWSRMEGRNFVYKMELLMAAMTPCP |
| Length | 272 |
| Position | Head |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.301 |
| Instability index | 56.80 |
| Isoelectric point | 9.15 |
| Molecular weight | 30430.50 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29159
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.48| 24| 161| 71| 94| 1
---------------------------------------------------------------------------
71- 94 (44.24/25.42) DSLASRIEDPQIQAHWSNI...NDVYE
234- 260 (42.25/24.02) DAKWSHLRGPSKEVHWSRMegrNFVYK
---------------------------------------------------------------------------
|