<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29153
| Description |
Uncharacterized protein |
| Sequence | QGGVSHMQGMMPHQGLGQQMVHPTPGGGAQMQGQWRQPLGACLGQILMAGQRGAVPQSGMPQVSSVMEDEILMDLI |
| Length | 76 |
| Position | Unknown |
| Organism | Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Tetraodon.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.184 |
| Instability index | 61.70 |
| Isoelectric point | 5.76 |
| Molecular weight | 7995.21 |
| Publications | PubMed=15496914
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29153
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.34| 15| 22| 2| 22| 1
---------------------------------------------------------------------------
2- 17 (27.14/15.33) GGVSHMQGMMpHQGLG
26- 40 (32.20/ 6.85) GGGAQMQGQW.RQPLG
---------------------------------------------------------------------------
|