<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29136
| Description |
Mediator complex subunit 30 |
| Sequence | MATPPVSGTGVPPGSFAGQQAQAAREVNTATLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTHQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPVEQLIPYVEEDGLKHDDRGIANQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINGMLAMRN |
| Length | 179 |
| Position | Head |
| Organism | Latimeria chalumnae (Coelacanth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.527 |
| Instability index | 41.46 |
| Isoelectric point | 8.48 |
| Molecular weight | 20480.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29136
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.82| 26| 51| 70| 113| 1
---------------------------------------------------------------------------
70- 96 (42.46/55.62) HQDRlG....................KLQEHLRQLSILFRKLR.LVYD
124- 170 (32.36/ 9.93) HDDR.GianqlrfaseerreimevnkKLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|