<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29135
Description |
Uncharacterized protein |
Sequence | MIGICLTHRLSVWCALSSYSSHNKGQASPKQRKRHREDIEDYNNLFPLDDTQPSKLMRLLSSNEEDPNVLSSPSDRSMSSSLSASQLHTVNMRDPLNRVLANLFLLISSILSAKTAGPHTQFVQWFMEECVDCIEQGTRGNILQFMPFTMVSELVKLSAMSNSKIVLAITDLTLPLGRRVAAKAITAL |
Length | 188 |
Position | Tail |
Organism | Latimeria chalumnae (Coelacanth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.116 |
Instability index | 60.81 |
Isoelectric point | 8.40 |
Molecular weight | 20934.92 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29135
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.93| 21| 26| 43| 68| 1
---------------------------------------------------------------------------
47- 67 (37.59/28.35) PLDDTQPSKL..MRLLSSNEEDP
73- 95 (33.33/11.00) PSDRSMSSSLsaSQLHTVNMRDP
---------------------------------------------------------------------------
|