<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29118
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAASDKSTKEKLLSCLDDLEVLCRELIEMLAISRNQKLPQPGEESQQILEMLIQRDGEFQELMKVALEQGKLHQEMQQLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIEKARKGAISSEELIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGFLGQMSNLPTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDVSMNMLPPNHSNDFMLEPLGHNKENEDDVEVMSTDSSSSSSDSD |
| Length | 253 |
| Position | Middle |
| Organism | Latimeria chalumnae (Coelacanth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.647 |
| Instability index | 54.22 |
| Isoelectric point | 4.87 |
| Molecular weight | 28280.62 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29118
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.22| 28| 33| 54| 86| 1
---------------------------------------------------------------------------
55- 84 (40.09/31.61) RDGEFQELMKvALEQGK......LHQEMQQLeKEVE
86- 119 (35.13/18.47) RDSDIQQLQK.QLKEAEhilataVYQAKEKL.KSIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.78| 14| 36| 142| 158| 2
---------------------------------------------------------------------------
142- 158 (24.78/28.31) NAVCAPLtwvPGDP....RRP
179- 196 (23.00/15.09) NGVNGHL...PGDAlaagRLP
---------------------------------------------------------------------------
|