<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29115
Description |
Transcription elongation factor A2 |
Sequence | FQSQFLLITCWQIFFFQDGAMDLLQELKNIPMTLDMLQSTRIGMSVNAVRKQSSEEEVITLAKSLIKSWKKLLVVVDNSAIGGGGGVHVPTSGEVGKRVSPPSSNKKPDTPKTPTTPKMTTFPAVPVTTDAVRTKCREMLIQALQTDNDYIAIGTDCDHMAGQIEEFLRLKIKSVKKNKNKTKPRIDGFQNPGIFRHCKSRSISSQIVGLPRLEEMASNELKEMRKALTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQIRSADEPMTTFVVCNECGNRWKVSTKKKKKKLYITAQAPPPPKQNKTTKQKKTYLCSISDCN |
Length | 327 |
Position | Unknown |
Organism | Latimeria chalumnae (Coelacanth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.532 |
Instability index | 48.68 |
Isoelectric point | 9.66 |
Molecular weight | 36595.24 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29115
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.25| 13| 202| 101| 113| 1
---------------------------------------------------------------------------
101- 113 (25.28/14.74) PPSSNKKPDTPKT
306- 318 (23.97/13.62) PPKQNKTTKQKKT
---------------------------------------------------------------------------
|