<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29114
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | ILPMANERLRVLEEIEKEIAAILQNAGSVTSELSKEKPNERLLDRQASQFTASVQKVESELSNQIRYLTQVATGQPHEGSSYSARKDCQMALHRVDHARRKLGELARTCEQMLEPQ |
Length | 116 |
Position | Head |
Organism | Latimeria chalumnae (Coelacanth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.674 |
Instability index | 42.23 |
Isoelectric point | 6.36 |
Molecular weight | 13130.72 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29114
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.00| 24| 30| 6| 34| 1
---------------------------------------------------------------------------
6- 34 (28.69/31.69) NERLrvLEEIEKEIAAILQnagSVTSELS
39- 62 (40.31/25.88) NERL..LDRQASQFTASVQ...KVESELS
---------------------------------------------------------------------------
|