<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29104
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFSSLFGQAEPPPPPASSLGFGAGKPPGPVSVPPPDDGSRKLSALHEPFYLLRELPGSTELTGSTNLITHYNLEHTYNKFCGKKVKEKLSNFLPDLPDTGMIDLPGAQDNSCLRLLIEKPPICGNSFNPLTGTLLTGFRLHAGPVRQE |
| Length | 150 |
| Position | Head |
| Organism | Latimeria chalumnae (Coelacanth) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.375 |
| Instability index | 43.68 |
| Isoelectric point | 6.07 |
| Molecular weight | 16166.24 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29104
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.03| 15| 18| 15| 29| 1
---------------------------------------------------------------------------
15- 29 (30.11/13.96) PPP.ASSLGFGAGKPP
35- 50 (24.92/10.51) PPPdDGSRKLSALHEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.32| 29| 47| 56| 84| 2
---------------------------------------------------------------------------
56- 84 (52.01/29.24) ELPGSTELTGSTNLITHYNL.EHTYNKFCG
105- 134 (47.32/26.06) DLPGAQDNSCLRLLIEKPPIcGNSFNPLTG
---------------------------------------------------------------------------
|