<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29103
Description |
Uncharacterized protein |
Sequence | MAIPMETQLQTIFEDVVKTESIEEAFPGMFMDTPEDERTKLISCLGAFRQYWTSLPQESHEQCVQWVVRFIHGQHSPKRISFLYDCLAMAVETGLLPPR |
Length | 99 |
Position | Tail |
Organism | Latimeria chalumnae (Coelacanth) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Coelacanthiformes> Coelacanthidae> Latimeria.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.190 |
Instability index | 55.30 |
Isoelectric point | 4.89 |
Molecular weight | 11463.07 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29103
No repeats found
No repeats found
|