<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29101
Description |
Uncharacterized protein |
Sequence | MSYWTLNPYTKNDKTRYSVVIQQSPKNSTKPLQVINLPKLPLDDIKLVEAASHINHLSLEQLIHQVMHVRSLHLLLQLKDMLKKHRKDDQSFIVRDSVDQPVILVIPLLGKGERSSLRVYVDLQTGILVPSLYDVEAIELEKMEKEINEKQTSLLTWINTLHSQLLRKCFEHAVQHLSVVYLDNIPLLEEHKDFTGDHQNRIFIRFNRHPYYYLVVHFSTIGTDQQYSLLKTTNQPVNIAKPQSPKPLIVQSVVNLRQTVNI |
Length | 262 |
Position | Tail |
Organism | Ciona savignyi (Pacific transparent sea squirt) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.279 |
Instability index | 49.24 |
Isoelectric point | 8.98 |
Molecular weight | 30447.90 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29101
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.55| 11| 217| 23| 37| 1
---------------------------------------------------------------------------
23- 37 (16.80/17.94) QSPknstKPL...QVINL
243- 256 (16.76/ 7.61) QSP....KPLivqSVVNL
---------------------------------------------------------------------------
|