<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29095

Description Uncharacterized protein
SequenceNEEEVLHIAKKLDKMVAKKSADHALDVLKALKKLPISLDTLQKTRIGMSVNNIRKQTTDGEVAIAAKQLIKGWKKLVSGKFVFLMLSTSLIFFLISEPNSTPKKSEEKQEKQDPGNKVSTNISKSNSTKFPQTPRTRLRLRPTGVPVRDKCREMLVRGLQTDNTSGHSDQHCAFLAAAVEDAIYAEFKDTGVKYKNRIRSRFSNLKDTRNSLLRQNVLNGILKPEQIAKMTAEEMASDEMKKRREEYEEQNIKDHQMSVNEGTKTDMFVCGRCKGRACTYNQLQTRSADEPMTTFVFCTECGNRWKFC
Length308
PositionUnknown
OrganismCiona savignyi (Pacific transparent sea squirt)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia> Cionidae> Ciona.
Aromaticity0.06
Grand average of hydropathy-0.680
Instability index51.73
Isoelectric point9.52
Molecular weight35029.95
Publications









Function






Annotated function


GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP29095
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.69|      18|      26|     258|     276|       1
---------------------------------------------------------------------------
  258-  276 (30.96/26.78)	SVNEGTKTDMFvCGRCKGR
  287-  304 (35.73/25.74)	SADEPMTTFVF.CTECGNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.94|      11|      18|     104|     114|       3
---------------------------------------------------------------------------
  104-  114 (18.92/12.44)	KSEEKQEKQDP
  124-  134 (20.02/13.55)	KSNSTKFPQTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.08|      14|      32|     204|     217|       4
---------------------------------------------------------------------------
  204-  217 (22.40/12.44)	NLKDTRNSLLRQNV
  239-  252 (23.68/13.47)	EMKKRREEYEEQNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.91|      10|      18|       6|      15|       5
---------------------------------------------------------------------------
    6-   15 (16.95/12.29)	LHIAKKLDKM
   25-   34 (14.96/10.05)	LDVLKALKKL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29095 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AKMTAEEMASDEMKKRREEYEEQNIKDHQMS
2) PKKSEEKQEKQDPGNKVSTNISKSNSTKFPQTPRTRLRLRPTG
228
102
258
144










Molecular Recognition Features






MoRF SequenceStartStop




NANANA