<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29094
Description |
Uncharacterized protein |
Sequence | NNEEEVLHIAKKLDKMVAKKSADHALDVLKALKKLPISLDTLQKTRIGMSVNNIRKQTTDGEVAIAAKQLIKGWKKLVSEPNSTPKKSEEKQEKQDPGNKVSTNISKSNSTKSSFKHYFDLSFYSQLALCVLSLPLALCSKPVTPLTYYSPQFPQTPRTRLRLRPTGVPVRDKCREMLVRGLQTDNTSGHSDQHCAFLAAAVEDAIYAEFKDTGVKYKNRIRSRFSNLKDTRNSLLRQNVLNGILKPEQIAKMTAEEMASDEMKKRREEYEEQNIKDHQMSVNEGTKTDMFVCGRCKGRACTYNQLQTRSADEPMTTFVFCTECGNRWKFC |
Length | 331 |
Position | Unknown |
Organism | Ciona savignyi (Pacific transparent sea squirt) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.698 |
Instability index | 54.99 |
Isoelectric point | 9.40 |
Molecular weight | 37609.75 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP29094
No repeats found
|