<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29094
| Description |
Uncharacterized protein |
| Sequence | NNEEEVLHIAKKLDKMVAKKSADHALDVLKALKKLPISLDTLQKTRIGMSVNNIRKQTTDGEVAIAAKQLIKGWKKLVSEPNSTPKKSEEKQEKQDPGNKVSTNISKSNSTKSSFKHYFDLSFYSQLALCVLSLPLALCSKPVTPLTYYSPQFPQTPRTRLRLRPTGVPVRDKCREMLVRGLQTDNTSGHSDQHCAFLAAAVEDAIYAEFKDTGVKYKNRIRSRFSNLKDTRNSLLRQNVLNGILKPEQIAKMTAEEMASDEMKKRREEYEEQNIKDHQMSVNEGTKTDMFVCGRCKGRACTYNQLQTRSADEPMTTFVFCTECGNRWKFC |
| Length | 331 |
| Position | Unknown |
| Organism | Ciona savignyi (Pacific transparent sea squirt) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.698 |
| Instability index | 54.99 |
| Isoelectric point | 9.40 |
| Molecular weight | 37609.75 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29094
No repeats found
|