<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29093
| Description |
Uncharacterized protein |
| Sequence | MSGNNEEEVLHIAKKLDKMVAKKSADHALDVLKALKKLPISLDTLQKTRIGMSVNNIRKQTTDGEVAIAAKQLIKGWKKLVSGKFVFLMLSTSVCVLCMLPGKPWKCQFPQTPRTRLRLRPTGVPVRDKCREMLVRGLQTDNTSGHSDQHCAFLAAAVEDAIYAEFKDTGVKYKNRIRSRFSNLKDTRNSLLRQNVLNGILKPEQIAKMTAEEMASDEMKKRREEYEEQNIKDHQMSVNEGTKTDMFVCGRCKGRACTYNQLQTRSADEPMTTFVFCTECGNRWKFC |
| Length | 287 |
| Position | Unknown |
| Organism | Ciona savignyi (Pacific transparent sea squirt) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.539 |
| Instability index | 49.00 |
| Isoelectric point | 9.47 |
| Molecular weight | 32644.61 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29093
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.26| 15| 20| 2| 16| 1
---------------------------------------------------------------------------
2- 16 (24.74/17.95) SGNNEEEVLHIAKKL
24- 38 (23.52/16.75) SADHALDVLKALKKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.08| 14| 32| 183| 196| 3
---------------------------------------------------------------------------
183- 196 (22.40/14.13) NLKDTRNSLLRQNV
218- 231 (23.68/15.27) EMKKRREEYEEQNI
---------------------------------------------------------------------------
|