<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29082
Description |
Uncharacterized protein |
Sequence | MAVASQNFAVSVAVDDMQKSVDTSSVPRFDKCLEHFFSLCDQLEVQLNLGHHQLSQALVSTQNTPFMRNVVLKENPNGAQLYGSYVNTVESQLHCVKEIHDLLSNCCKKLQEHQTTHPV |
Length | 119 |
Position | Tail |
Organism | Ciona savignyi (Pacific transparent sea squirt) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.259 |
Instability index | 18.64 |
Isoelectric point | 5.91 |
Molecular weight | 13340.96 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP29082
No repeats found
No repeats found
|