<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29075
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MDVLSHMFKLISQLWMANSDEHRMNDLPMSLKSECSMLPFHVVIPPLEPIPPPNSAISQLMNSNAPCSFTFGEAPQDNYVISARQQSMMHVAIPGSSGKIDSLRRTFLGKVPNQDLKECIRCGITTTCNNLLRTTLKVWDQRFVRSCVCG |
| Length | 150 |
| Position | Tail |
| Organism | Ciona savignyi (Pacific transparent sea squirt) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.126 |
| Instability index | 57.82 |
| Isoelectric point | 8.21 |
| Molecular weight | 16811.43 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29075
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.19| 21| 25| 101| 123| 1
---------------------------------------------------------------------------
101- 123 (31.60/35.24) DSLRRTFLgKVPNQD.LKECIrCG
129- 150 (36.59/27.80) NNLLRTTL.KVWDQRfVRSCV.CG
---------------------------------------------------------------------------
|