<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29066
| Description |
Uncharacterized protein |
| Sequence | MVLRNLLLEKILVKGLDEDLYFENGTIDLFTESQYECMRRISEHVMSAVLQYSSYSTPQPELSLKYMLLWLQSYKNLFTDPCNVCGKHLDGGLPPVWRDFRNPVACHDNCRS |
| Length | 112 |
| Position | Tail |
| Organism | Ciona savignyi (Pacific transparent sea squirt) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.258 |
| Instability index | 71.74 |
| Isoelectric point | 5.51 |
| Molecular weight | 13049.89 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29066
No repeats found
No repeats found
|