Description | Mediator of RNA polymerase II transcription subunit 1 |
Sequence | MGLDWETKSSRMLDEESSREGESSEELMEMLRKKNETKSFDDIIKLLHVVSSEQKARIMLRSCMDKVLMNMGGSYNLRDVIDRLRSVASVNGLRFNVVLDQDTSSPGTTCQILADMFTMEVTLDESQFGGLSVLDVKIVYSDHVKSCPNMVQIIREGKFLELSKQLKGLTDIYPPSMDQTTRTRMYMALQSLDMDLAKMSQVYRDSHGDSDTLHIIMNGYVGLLFPR |
Length | 227 |
Position | Middle |
Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia> Cionidae> Ciona. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.311 |
Instability index | 50.12 |
Isoelectric point | 5.18 |
Molecular weight | 25814.43 |
Publications | PubMed=12481130 PubMed=15114417 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364059 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP29060 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) ELMEMLR 2) MGLDWETKSSRMLDEE | 26 1 | 32 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab