<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29041

Description "Transcription elongation factor A (SII), 3"
SequenceMTREEELVRIAKQLDKMVSRNNTDGAMDLLRELKSFNMTLRLLQETRIGVSVNSIRKHCTDEEVIALAKVLIKDWKRLLEKKQSTKNGKEKSDEQRGRKGSAGDLGDQKYPEEPPNQPPHCEIRREKHKEEQKKRSAVEDAEVNHVTQSEKAKPDTPKSPTTPTSPMSPGGALPPHLNTGDSVRDKCIEMLAAALRTDNDYKEFGTNCDSMAAEIEDHILLSEIKATDMKYKNRVRSRISNLKDPKNPGLRKNVLAGTLALSRIASMSAEEMASDELKQLRNTLTQEAIREHQMAKTGGTSTDLLQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVKLLLFHPICFKKTHPKHFFFFLSNFQFC
Length372
PositionUnknown
OrganismTakifugu rubripes (Japanese pufferfish) (Fugu rubripes)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
Aromaticity0.05
Grand average of hydropathy-0.814
Instability index50.92
Isoelectric point9.10
Molecular weight42230.89
Publications
PubMed=21551351

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP29041
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.69|      31|      54|      80|     120|       1
---------------------------------------------------------------------------
   80-  120 (50.95/55.71)	EKKQS..........TKNGKEKSDEQRGRKGsagdlgdqkyPEEP..PN..QPPH
  132-  176 (41.74/26.05)	QKKRSavedaevnhvTQSEKAKPDTPKSPTT..........PTSPmsPGgaLPPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.68|      12|      27|     302|     313|       4
---------------------------------------------------------------------------
  302-  313 (21.87/11.48)	TDLLQCGKCKKK
  330-  341 (22.81/12.24)	TTFVLCNECGNR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP29041 with Med26 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) LLEKKQSTKNGKEKSDEQRGRKGSAGDLGDQKYPEEPPNQPPHCEIRREKHKEEQKKRSAVEDAEVNHVTQSEKAKPDTPKSPTTPTSPMSPGGALPPHLNTGDSVRDKCIEM
78
190

Molecular Recognition Features

MoRF SequenceStartStop
NANANA