<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29038
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSTLFGQNEAQGPPGSSSLGFGPSKPPPPLPQSQVPLAAQMPPQLGDEGPALRKPGAMNEPFYLLRELPGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPMIDCPGTQDGSSLRSLIDKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHKHHRPQDPLPQTPSDTDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLTGSQPNSSSLR |
| Length | 241 |
| Position | Head |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.089 |
| Instability index | 54.68 |
| Isoelectric point | 9.81 |
| Molecular weight | 26746.35 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
|
| GO - Cellular Component | nuclear MIS12/MIND complex GO:0000818 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP29038
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.57| 27| 113| 99| 127| 1
---------------------------------------------------------------------------
99- 127 (44.47/26.61) KKVKEKLSN.FLPELPMIdcPGTQ.DGSSLR
213- 241 (41.10/18.58) KKDKKKKKNrHSPDHPGL..TGSQpNSSSLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.31| 17| 18| 170| 186| 2
---------------------------------------------------------------------------
170- 186 (33.39/14.39) PKKKSKHKHKHHRPQDP
191- 207 (30.92/12.86) PSDTDPKKKKKKRDDDP
---------------------------------------------------------------------------
|