<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29029
| Description |
Uncharacterized protein |
| Sequence | MGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFLEDPLPTTDVFAGCQIPYPKREFLNEDEPEEKTEKNQTQQHQQTTGQAQAQNQQQTVAQQATSQQTSAQTNGTTGATGGTVGGALQHGQDQAPANKKPRIGAPTATGMLPSEYQHSGPRLGYQSNIQGSSQPQSTLGYSSSSQQSSQYSHQTQRY |
| Length | 331 |
| Position | Kinase |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.782 |
| Instability index | 50.55 |
| Isoelectric point | 6.51 |
| Molecular weight | 37182.12 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP29029
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.86| 15| 17| 291| 307| 1
---------------------------------------------------------------------------
291- 307 (23.07/21.53) HSgpRLGYQSNIQGSSQ
309- 323 (25.79/15.13) QS..TLGYSSSSQQSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.61| 21| 43| 216| 238| 2
---------------------------------------------------------------------------
216- 238 (32.75/21.53) QHQQttGQAQAQNQQQTVAQQAT
262- 282 (38.86/20.10) QHGQ..DQAPANKKPRIGAPTAT
---------------------------------------------------------------------------
|