<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29022
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | SLRVMETEEQARNRFQTELEFVQCLANPNYLNFLAQRGVFREKTFINYLKYLLYWKEPEYAKYLKYPHCLHMLELLQYEHFRKELVNAQCAKFIDEQQLLHWQHYSRKRMRLQQALAEQQQPQQHPPPHGNATTK |
| Length | 135 |
| Position | Middle |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.851 |
| Instability index | 45.81 |
| Isoelectric point | 8.97 |
| Molecular weight | 16526.74 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29022
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.75| 20| 21| 62| 81| 1
---------------------------------------------------------------------------
62- 81 (38.58/22.06) KYLKYPHCLHMLE...LLQYEHF
83- 105 (32.17/17.46) KELVNAQCAKFIDeqqLLHWQHY
---------------------------------------------------------------------------
|