<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29016

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMPRASLNPSIPPPNATGAVTSAVGGAAALTQQVPQHSMMSSPSPVQASQSMLPPPQPSPQPPASQPNSASSGPTPSPGGFQPSPSPQPSQSPSNARPVSNYSVPSPGPLNTPGNPSSVMSPAGPTSLEDQQYMEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLNILTDPTTRCPLKTLQKCEIALEKLKNDMAVPTPPPVATKQQYLCQPLLDAVMTNIRSPVFNHSLYRTFAPAMSAIHGPPISSPNICSRKRKPEDEERQSIPNILQGEVARLDAKFLVNLDPSHSSTNGTVHLICKLDDKNLPSVPPLLLRVPADYPEQSPYWAEDGDQYGTNSFLQKVHRTMTSKLLQLPDKHSVTELLNTWAQSVQQACRSAA
Length385
PositionTail
OrganismTakifugu rubripes (Japanese pufferfish) (Fugu rubripes)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
Aromaticity0.04
Grand average of hydropathy-0.583
Instability index82.42
Isoelectric point9.13
Molecular weight41712.06
Publications
PubMed=21551351

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP29016
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.36|      26|      28|      53|      80|       1
---------------------------------------------------------------------------
   53-   80 (51.24/17.52)	PPPQPSPQPPASQPNSASSgpTPSPGGF
   84-  109 (49.12/13.22)	PSPQPSQSPSNARPVSNYS..VPSPGPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.59|      21|      41|     262|     286|       2
---------------------------------------------------------------------------
  262-  286 (30.51/27.51)	KPEDEERQSIPNILqgevARLDAKF
  306-  326 (37.08/22.49)	KLDDKNLPSVPPLL....LRVPADY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.10|      17|      41|     199|     215|       3
---------------------------------------------------------------------------
  199-  215 (31.09/14.47)	MAVPTPPPVATKQQYLC
  222-  236 (19.18/ 6.22)	VMTNIRSPVFNHSLY..
  243-  257 (26.83/11.52)	MSAIHGPPISSPN..IC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.00|      16|      28|     133|     148|       4
---------------------------------------------------------------------------
  127-  142 (26.72/15.61)	LEDQQYM..............EKLKQLSKY
  143-  172 (16.28/ 6.91)	IEPLRRMinkidknedrkkdlSKMKSLLNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.26|      14|      30|       2|      15|       5
---------------------------------------------------------------------------
    2-   15 (26.98/12.28)	PRASLNPSIPPPNA
   34-   47 (27.29/12.51)	PQHSMMSSPSPVQA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP29016 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IEPLRRMINKIDKNEDRKKDLSKMKSLLNI
2) MPRASLNPSIPPPNATGAVTSAVGGAAALTQQVPQHSMMSSPSPVQASQSMLPPPQPSPQPPASQPNSASSGPTPSPGGFQPSPSPQPSQSPSNARPVSNYSVPSPGPLNTPGNPSSVMSPAGPTSLEDQQYMEKLKQLS
143
1
172
140










Molecular Recognition Features






MoRF SequenceStartStop




NANANA