<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP29016
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MPRASLNPSIPPPNATGAVTSAVGGAAALTQQVPQHSMMSSPSPVQASQSMLPPPQPSPQPPASQPNSASSGPTPSPGGFQPSPSPQPSQSPSNARPVSNYSVPSPGPLNTPGNPSSVMSPAGPTSLEDQQYMEKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLNILTDPTTRCPLKTLQKCEIALEKLKNDMAVPTPPPVATKQQYLCQPLLDAVMTNIRSPVFNHSLYRTFAPAMSAIHGPPISSPNICSRKRKPEDEERQSIPNILQGEVARLDAKFLVNLDPSHSSTNGTVHLICKLDDKNLPSVPPLLLRVPADYPEQSPYWAEDGDQYGTNSFLQKVHRTMTSKLLQLPDKHSVTELLNTWAQSVQQACRSAA |
| Length | 385 |
| Position | Tail |
| Organism | Takifugu rubripes (Japanese pufferfish) (Fugu rubripes) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata>
Eupercaria> Tetraodontiformes> Tetradontoidea> Tetraodontidae> Takifugu.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.583 |
| Instability index | 82.42 |
| Isoelectric point | 9.13 |
| Molecular weight | 41712.06 |
| Publications | PubMed=21551351
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP29016
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.36| 26| 28| 53| 80| 1
---------------------------------------------------------------------------
53- 80 (51.24/17.52) PPPQPSPQPPASQPNSASSgpTPSPGGF
84- 109 (49.12/13.22) PSPQPSQSPSNARPVSNYS..VPSPGPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.59| 21| 41| 262| 286| 2
---------------------------------------------------------------------------
262- 286 (30.51/27.51) KPEDEERQSIPNILqgevARLDAKF
306- 326 (37.08/22.49) KLDDKNLPSVPPLL....LRVPADY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.10| 17| 41| 199| 215| 3
---------------------------------------------------------------------------
199- 215 (31.09/14.47) MAVPTPPPVATKQQYLC
222- 236 (19.18/ 6.22) VMTNIRSPVFNHSLY..
243- 257 (26.83/11.52) MSAIHGPPISSPN..IC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.00| 16| 28| 133| 148| 4
---------------------------------------------------------------------------
127- 142 (26.72/15.61) LEDQQYM..............EKLKQLSKY
143- 172 (16.28/ 6.91) IEPLRRMinkidknedrkkdlSKMKSLLNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.26| 14| 30| 2| 15| 5
---------------------------------------------------------------------------
2- 15 (26.98/12.28) PRASLNPSIPPPNA
34- 47 (27.29/12.51) PQHSMMSSPSPVQA
---------------------------------------------------------------------------
|