<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28985
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD |
Length | 270 |
Position | Middle |
Organism | Pan troglodytes (Chimpanzee) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.621 |
Instability index | 50.47 |
Isoelectric point | 5.02 |
Molecular weight | 29745.10 |
Publications | PubMed=16136131
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
transcription by RNA polymerase II GO:0006366 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP28985
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 104.57| 27| 28| 55| 81| 1
---------------------------------------------------------------------------
29- 49 (30.78/20.44) RLLSALE...D...LEVL..SR..ELIEMLA
55- 81 (47.46/35.46) KLLQAGE...ENQVLELLI.HRDGEFQELMK
84- 112 (26.32/16.43) ..LNQGKihhEMQVLEKEVeKRDSDIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.07| 23| 23| 216| 238| 2
---------------------------------------------------------------------------
216- 238 (44.66/31.67) LAPQYPWQSNDMSMNMLPPNHSS
242- 264 (39.42/27.08) LEPPGHNKENEDDVEIMSTDSSS
---------------------------------------------------------------------------
|