<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28981
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNGRHRDSAGAVGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPAAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
| Length | 211 |
| Position | Head |
| Organism | Pan troglodytes (Chimpanzee) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pan.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.603 |
| Instability index | 56.74 |
| Isoelectric point | 9.62 |
| Molecular weight | 22154.16 |
| Publications | PubMed=16136131
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28981
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.37| 13| 14| 26| 39| 1
---------------------------------------------------------------------------
26- 39 (23.20/ 7.71) GAQADPPPPPtALG
43- 55 (30.17/ 8.28) GKPPPPPPPP.AGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 14| 39| 84| 97| 6
---------------------------------------------------------------------------
84- 97 (25.31/12.66) LMRELPGSTELTGS
125- 138 (27.69/14.44) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|