<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28967
| Description |
MED28 isoform 1 |
| Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 178 |
| Position | Head |
| Organism | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pongo.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.452 |
| Instability index | 61.27 |
| Isoelectric point | 5.39 |
| Molecular weight | 19519.94 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP28967
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (21.37/22.81) ELRNELQ.RKDALVQkH
135- 150 (24.48/19.69) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|