<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28950
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANSTEEYAQLFAALIARTAKDIDARNCIPLEEESFSALFAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQSLPDS |
| Length | 144 |
| Position | Middle |
| Organism | Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Pongo.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.264 |
| Instability index | 55.33 |
| Isoelectric point | 4.40 |
| Molecular weight | 15680.29 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | blastocyst development GO:0001824 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP28950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.05| 24| 26| 54| 79| 1
---------------------------------------------------------------------------
54- 79 (36.08/32.22) YAQLFAA.LIARTAKDIDARNCipLEE
82- 106 (36.97/25.26) FSALFAAsLYKLEEENHEAATC..LED
---------------------------------------------------------------------------
|